Themes / Group
Active · newly observed relationshipLatest completed snapshot · 16:55 ET

MARKET-DISCOVERED GROUP

Biotechnology · IMVT

THE TRADER READShared activity without a clean directional read

Price direction is split across 24 measured members. Capital-flow confirmation is unavailable.

Price breadth11 up · 13 downRelative median unavailable
Capital-flow alignmentUnavailablePrice breadth is not yet confirmed by flow
Activity nowBuilding_pressureActivity score 49/100
Evidence depth0 support daysLow sample—context, not a validated playbook
EVIDENCE CLOCK

What happened, in timestamp order

1 timed event
TIMING READA causal timing read is unavailable because no material member price onset could be timestamped.
2 earlier filing context receipts

WED, FEB 25ACAD filing documented shared operating contextproduct pipeline / R&D affecting expense · date precision only

WED, AUG 5IMVT filing documented shared operating contextproduct pipeline / R&D affecting expense · date precision only

Headline times and retained activity confirmations are point-in-time evidence. Price order is inferred from aligned 5-minute bars. Filing evidence has date precision only and is context, not an intraday catalyst claim.

01 · WHAT IS HAPPENING

The move, the flow and who is driving it

Price breadth, unusual activity and signed capital flow are separate observations
Price sequence unavailableA timestamped price sequence is unavailable.
RELATIVE CO-MOVEMENT

How the members are behaving together

Session-normalized

Observed intraday paths are not available for this group yet.

02 · WHY IT MATTERS

Why now and where the move could travel

Context and lead/lag links are evidence, not proof of causation or a forecast
WHY THIS GROUP EXISTS

Shared filing context

34/37 members covered

Moderate filing support: the strongest shared 10-Q/K outlook is operating setup (near-term outlook) across ACAD, ALMS, BEAM, CELC, CGON, CLDX, COGT, CRSP, CYTK, DNTH, DYN, EWTX, GPCR, IBRX, IMNM, IRON, KYMR, MAZE, MRNA, NAMS, PCVX, PRAX, PTGX, RCUS, ROIV, RVMD, RYTM, SMMT, SRRK, SYRE, TARS, VKTX, VRDN.

product pipeline / R&D affecting expense

“Research and development costs related to neurological diseases, which include MG and CIDP, increased $4.5 million, primarily due to higher costs related to our clinical trials of IMVT-1402 in neurological diseases, partially offset by lower costs related to the wind-down of our batoclimab clinical trials.”

IMVT 10-Q · 2026-08-06
product pipeline / R&D

“In addition, accounts receivable decreased $3.1 million, reflecting the collection of amounts owed to us under research and development cost-sharing arrangements with a third party.”

IMVT 10-Q · 2026-02-06
credit / rates affecting interest expense

“Interest expense during the three months ended June 30, 2026, was attributable to the 2031 Notes, the 2032 Notes and the Amended A&R Loan Agreement.”

CELC 10-Q · 2026-08-13
CONFIRMATION NETWORK

Outsiders and cross-asset links

0 outsiders confirming
ROIV → SLVInverse historical lead/lag · strength -0.15
ROIV → UNGPositive historical lead/lag · strength 0.12

Filing-linked outsiders test whether the move is spreading beyond the established cohort.

No high-confidence filing-linked outsiders are available for this group yet.

03 · WHO IS IN IT

Member participation

Unusual activity and daily price direction are shown separately
SYREIMVTMAZEGPCRROIVVRDNCRSPSRRKDYNALMSRVMDCELCPTGXIMNMIRONRCUSRYTMVKTXMRNADNTHPRAXCOGTBEAMPCVX

31/37 active11 rising · 13 falling

MemberUnusual activityToday's moveRead now
SYRESpyre Therapeutics, Inc.
Elevated · 100/100
+2.9%
Active; unclassifiedHistorical role unavailable
IMVTImmunovant, Inc.
Most unusual · 94/100
+1.4%
Active; unclassifiedHistorical role unavailable
MAZEMaze Therapeutics, Inc.
Elevated · 93/100
+4.4%
Active; unclassifiedHistorical role unavailable
GPCRStructure Therapeutics Inc.
Elevated · 79/100
-0.6%
Active; unclassifiedHistorical role unavailable
ROIVRoivant Sciences Ltd.
Elevated · 68/100
+3.2%
Active; unclassifiedHistorical role unavailable
VRDNViridian Therapeutics, Inc.
Elevated · 57/100
+3.6%
Active; unclassifiedHistorical role unavailable
CRSPCRISPR Therapeutics AG
Elevated · 56/100
-2.3%
Active; unclassifiedHistorical role unavailable
SRRKScholar Rock Holding Corporation
Elevated · 54/100
+5.0%
Active; unclassifiedHistorical role unavailable
DYNDyne Therapeutics, Inc.
Elevated · 49/100
-0.6%
Active; unclassifiedHistorical role unavailable
ALMSAlumis Inc.
Elevated · 40/100
-2.5%
Active; unclassifiedHistorical role unavailable
RVMDRevolution Medicines, Inc.
Elevated · 39/100
+1.9%
Active; unclassifiedHistorical role unavailable
CELCCelcuity Inc.
Elevated · 39/100
+0.8%
Active; unclassifiedHistorical role unavailable
PTGXProtagonist Therapeutics, Inc.
Elevated · 38/100
-0.7%
Active; unclassifiedHistorical role unavailable
IMNMImmunome, Inc.
Elevated · 38/100
+0.6%
Active; unclassifiedHistorical role unavailable
IRONDisc Medicine, Inc.
Elevated · 37/100
+0.3%
Active; unclassifiedHistorical role unavailable
RCUSArcus Biosciences, Inc.
Quiet · 32/100
-0.3%
Watch / laggardHistorical role unavailable
RYTMRhythm Pharmaceuticals, Inc.
Quiet · 32/100
-0.1%
Watch / laggardHistorical role unavailable
VKTXViking Therapeutics, Inc.
Quiet · 31/100
-0.8%
Watch / laggardHistorical role unavailable
MRNAModerna, Inc.
Quiet · 25/100
-2.4%
Watch / laggardHistorical role unavailable
DNTHDianthus Therapeutics, Inc.
Quiet · 24/100
+0.7%
Watch / laggardHistorical role unavailable
PRAXPraxis Precision Medicines, Inc.
Quiet · 21/100
-1.8%
Watch / laggardHistorical role unavailable
COGTCogent Biosciences, Inc.
Quiet · 21/100
-1.2%
Watch / laggardHistorical role unavailable
BEAMBeam Therapeutics Inc.
Quiet · 20/100
-1.9%
Watch / laggardHistorical role unavailable
PCVXVaxcyte, Inc.
Quiet · 18/100
-0.7%
Watch / laggardHistorical role unavailable
View exact member values
TICKERCompanyRole nowTodayObserved historyTrader interpretation
SYRESpyre Therapeutics, Inc.Participating+2.9%—Price participation is not yet confirmed by per-name flow.
IMVTImmunovant, Inc.Most unusual+1.4%—Most unusual activity in this snapshot; performance direction may differ.
MAZEMaze Therapeutics, Inc.Participating+4.4%—Price participation is not yet confirmed by per-name flow.
GPCRStructure Therapeutics Inc.Participating-0.6%—Price participation is not yet confirmed by per-name flow.
ROIVRoivant Sciences Ltd.Participating+3.2%—Price participation is not yet confirmed by per-name flow.
VRDNViridian Therapeutics, Inc.Participating+3.6%—Price participation is not yet confirmed by per-name flow.
CRSPCRISPR Therapeutics AGParticipating-2.3%—Price participation is not yet confirmed by per-name flow.
SRRKScholar Rock Holding CorporationParticipating+5.0%—Price participation is not yet confirmed by per-name flow.
DYNDyne Therapeutics, Inc.Participating-0.6%—Price participation is not yet confirmed by per-name flow.
ALMSAlumis Inc.Participating-2.5%—Price participation is not yet confirmed by per-name flow.
RVMDRevolution Medicines, Inc.Participating+1.9%—Price participation is not yet confirmed by per-name flow.
CELCCelcuity Inc.Participating+0.8%—Price participation is not yet confirmed by per-name flow.
PTGXProtagonist Therapeutics, Inc.Participating-0.7%—Price participation is not yet confirmed by per-name flow.
IMNMImmunome, Inc.Participating+0.6%—Price participation is not yet confirmed by per-name flow.
IRONDisc Medicine, Inc.Participating+0.3%—Price participation is not yet confirmed by per-name flow.
RCUSArcus Biosciences, Inc.Quiet / lagging-0.3%—Not participating yet; a breadth test or a genuine divergence.
RYTMRhythm Pharmaceuticals, Inc.Quiet / lagging-0.1%—Not participating yet; a breadth test or a genuine divergence.
VKTXViking Therapeutics, Inc.Quiet / lagging-0.8%—Not participating yet; a breadth test or a genuine divergence.
MRNAModerna, Inc.Quiet / lagging-2.4%—Not participating yet; a breadth test or a genuine divergence.
DNTHDianthus Therapeutics, Inc.Quiet / lagging+0.7%—Not participating yet; a breadth test or a genuine divergence.
PRAXPraxis Precision Medicines, Inc.Quiet / lagging-1.8%—Not participating yet; a breadth test or a genuine divergence.
COGTCogent Biosciences, Inc.Quiet / lagging-1.2%—Not participating yet; a breadth test or a genuine divergence.
BEAMBeam Therapeutics Inc.Quiet / lagging-1.9%—Not participating yet; a breadth test or a genuine divergence.
PCVXVaxcyte, Inc.Quiet / lagging-0.7%—Not participating yet; a breadth test or a genuine divergence.

04 · HAS THIS HAPPENED BEFORE

Identity history versus measured outcomes

Structural recurrence is not the same as a validated trading outcome
POINT-IN-TIME LIVE OUTCOMES

Live outcome ledger collecting

0/0 events completed

No completed point-in-time outcome is available yet. New live confirmations are now retained with their exact observation timestamp; statistics appear only after the corresponding candles complete.

No point-in-time live observations have completed yet.
Low structural sample

Only 0 completed episodes across 0 active sessions; treat history as context, not a validated playbook. These episode counts describe recurrence; the outcome ledger above is the only forward-performance evidence.

Structural support0 daysHow often the cohort identity was observed
Completed episodes0Separate periods of broad group activity
Active sessions0Completed session observations, not trades

Historical cohort observations are not available yet.