Themes / Group
Inactive · newly observed relationshipLatest completed snapshot · Jun 16 · 13:38 ET

MARKET-DISCOVERED GROUP

Infrastructure Technology

THE TRADER READRecurring relationship, inactive in the latest snapshot

Price direction is split across 8 measured members. Capital-flow confirmation is unavailable.

Price breadth2 up · 6 downRelative median unavailable
Capital-flow alignmentUnavailablePrice breadth is not yet confirmed by flow
Activity nowCalmActivity score 5/100 · lift 0.8×
Evidence depth1 support daysLow sample—context, not a validated playbook
EVIDENCE CLOCK

What happened, in timestamp order

0 timed events
TIMING READA causal timing read is unavailable because no material member price onset could be timestamped.

No session event has enough timestamp precision to place on the clock.

2 earlier filing context receipts

THU, MAR 19AEVA filing documented shared operating contextcredit / rates affecting interest expense · date precision only

WED, MAR 25AMPG filing documented shared operating contextcredit / rates affecting interest expense · date precision only

Headline times and retained activity confirmations are point-in-time evidence. Price order is inferred from aligned 5-minute bars. Filing evidence has date precision only and is context, not an intraday catalyst claim.

01 · WHAT IS HAPPENING

The move, the flow and who is driving it

Price breadth, unusual activity and signed capital flow are separate observations
Price sequence unavailableA timestamped price sequence is unavailable.
RELATIVE CO-MOVEMENT

How the members are behaving together

Session-normalized

Observed intraday paths are not available for this group yet.

02 · WHY IT MATTERS

Why now and where the move could travel

Context and lead/lag links are evidence, not proof of causation or a forecast
WHY NOW

Verified recent context

0 items

No verified recent catalyst is attached to this move. The relationship may be market-led rather than news-led.

WHY THIS GROUP EXISTS

Shared filing context

14/18 members covered

Moderate filing support: the strongest shared 10-Q/K outlook is operating setup (near-term outlook) across AEVA, AMPG, APLD, CORZ, CRWV, IMSR, KRMN, MRCY, OUST, SMR, SPIR.

credit / rates affecting interest expense

“Other income (expense), net Other income (expense), net increased by $0.5 million for the year ended December 31, 2025 due interest expense of $0.7 million recorded on convertible debt, partially offset by a gain on foreign currency transactions.”

AEVA 10-K · 2026-03-20
demand / volume

“The WaaS market has witnessed significant growth in recent years, driven by the increasing demand for flexible and scalable warehousing solutions.”

SYM 10-K · 2025-11-24
product pipeline / R&D affecting expense

“Research and Development Expenses For the Three Months Ended Change March 28, 2026 March 29, 2025 Amount % (dollars in thousands) Research and development $ 51,283 $ 57,960 $ (6,677) (12) % Percentage of total revenue 8 % 11 % The decrease in research and development expenses for the three months ended March 28, 2026, as compared to the three months ended March 29, 2025, is due to the following: Change (in thousands) Employee-related costs $ 528 Prototyping-related costs, allocated overhead expenses, and other (7,205) $ (6,677) Employee-related costs remained relatively flat for the three months ended March 28, 2026, as compared to the three months ended March 29, 2025.”

SYM 10-Q · 2026-05-06
CONFIRMATION NETWORK

Outsiders and cross-asset links

0 outsiders confirming

No qualified cross-asset lead/lag link is available for this group.

Filing-linked outsiders test whether the move is spreading beyond the established cohort.

CLSKNot confirming

CORZ · text peer

KEELNot confirming

APLD · text peer

HUTNot confirming

CORZ · text peer

DGXXNot confirming

CORZ · text peer

03 · WHO IS IN IT

Member participation

Unusual activity and daily price direction are shown separately
SYMSMRCORZMRCYAPLDNBISCRWVKRMNAEVAAMPGARQQIMSRLAESOUSTSERVSPIRTSSIWLAC

5/18 active2 rising · 6 falling

MemberUnusual activityToday's moveRead now
SYMSymbotic Inc.
Most unusual · 100/100
+1.0%
Active; unclassifiedActive in 0% of observed group sessions
SMRNuScale Power Corporation
Elevated · 72/100
+3.7%
Active; unclassifiedActive in 0% of observed group sessions
CORZCore Scientific, Inc.
Elevated · 48/100
-3.1%
Active; unclassifiedActive in 0% of observed group sessions
MRCYMercury Systems, Inc.
Elevated · 39/100
-2.9%
Active; unclassifiedActive in 0% of observed group sessions
APLDApplied Digital Corporation
Elevated · 37/100
-5.0%
Active; unclassifiedActive in 0% of observed group sessions
NBISNebius Group N.V.
Quiet · 34/100
-0.5%
Watch / laggardActive in 0% of observed group sessions
CRWVCoreWeave, Inc.
Quiet · 34/100
-2.1%
Watch / laggardActive in 0% of observed group sessions
KRMNKarman Holdings Inc.
Quiet · 29/100
-1.7%
Watch / laggardActive in 0% of observed group sessions
AEVAAeva Technologies, Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
AMPGAmplitech Group, Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
ARQQArqit Quantum Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
IMSRTerrestrial Energy Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
LAESSEALSQ Corp
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
OUSTOuster, Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
SERVServe Robotics Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
SPIRSpire Global, Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
TSSITSS, Inc.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
WLACWillow Lane Acquisition Corp.
Quiet · 0/100
—
Watch / laggardActive in 0% of observed group sessions
View exact member values
TICKERCompanyRole nowTodayObserved historyTrader interpretation
SYMSymbotic Inc.Most unusual+1.0%0% of 0 sessionsMost unusual activity in this snapshot; performance direction may differ.
SMRNuScale Power CorporationParticipating+3.7%0% of 0 sessionsPrice participation is not yet confirmed by per-name flow.
CORZCore Scientific, Inc.Participating-3.1%0% of 0 sessionsPrice participation is not yet confirmed by per-name flow.
MRCYMercury Systems, Inc.Participating-2.9%0% of 0 sessionsPrice participation is not yet confirmed by per-name flow.
APLDApplied Digital CorporationParticipating-5.0%0% of 0 sessionsPrice participation is not yet confirmed by per-name flow.
NBISNebius Group N.V.Quiet / lagging-0.5%0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
CRWVCoreWeave, Inc.Quiet / lagging-2.1%0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
KRMNKarman Holdings Inc.Quiet / lagging-1.7%0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
AEVAAeva Technologies, Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
AMPGAmplitech Group, Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
ARQQArqit Quantum Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
IMSRTerrestrial Energy Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
LAESSEALSQ CorpQuiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
OUSTOuster, Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
SERVServe Robotics Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
SPIRSpire Global, Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
TSSITSS, Inc.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.
WLACWillow Lane Acquisition Corp.Quiet / lagging—0% of 0 sessionsNot participating yet; a breadth test or a genuine divergence.

04 · HAS THIS HAPPENED BEFORE

Identity history versus measured outcomes

Structural recurrence is not the same as a validated trading outcome
POINT-IN-TIME LIVE OUTCOMES

Live outcome ledger collecting

0/0 events completed

No completed point-in-time outcome is available yet. New live confirmations are now retained with their exact observation timestamp; statistics appear only after the corresponding candles complete.

Only point-in-time live watcher observations and conservative same-day EOD observations are included. Later backfills and replay runs are excluded.
Low structural sample

Only 0 completed episodes across 0 active sessions; treat history as context, not a validated playbook. These episode counts describe recurrence; the outcome ledger above is the only forward-performance evidence.

Structural support1 dayHow often the cohort identity was observed
Completed episodes0Separate periods of broad group activity
Active sessions0Completed session observations, not trades
2026-06-1018 names in the durable cohort
MEMBER CONSISTENCY IN OBSERVED ACTIVE SESSIONS
AEVA0% · 0 episodes
AMPG0% · 0 episodes
APLD0% · 0 episodes
ARQQ0% · 0 episodes
CORZ0% · 0 episodes
CRWV0% · 0 episodes
IMSR0% · 0 episodes
KRMN0% · 0 episodes
LAES0% · 0 episodes
MRCY0% · 0 episodes
NBIS0% · 0 episodes
OUST0% · 0 episodes
SERV0% · 0 episodes
SMR0% · 0 episodes
SPIR0% · 0 episodes
SYM0% · 0 episodes
TSSI0% · 0 episodes
WLAC0% · 0 episodes